PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G284500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 264aa    MW: 29949.8 Da    PI: 8.6003
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G284500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.4e-161759448
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       WT+eEd  l+++vk +G + W+t++  m  +R +kqc++rw+++l
  Aqcoe3G284500.1.p 17 WTEEEDRELIRLVKNHGEK-WTTVSGSMD-RRIGKQCRDRWNNHL 59
                       *******************.*********.*************97 PP

2Myb_DNA-binding52.89.2e-1766108246
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          WT++Ed  +v a+k++ ++ W +Ia++++ gRt++q+k+rw++
  Aqcoe3G284500.1.p  66 SCWTEDEDRAFVVAHKRYNNR-WVKIAEEIN-GRTENQVKNRWNN 108
                        68*******************.*********.***********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.675959IPR017930Myb domain
SMARTSM007179.9E-131361IPR001005SANT/Myb domain
SuperFamilySSF466895.87E-2514106IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-221766IPR009057Homeodomain-like
CDDcd001671.89E-111759No hitNo description
PfamPF139212.2E-181774No hitNo description
PROSITE profilePS5129423.33160114IPR017930Myb domain
SMARTSM007176.4E-1564112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.6E-1867112IPR009057Homeodomain-like
CDDcd001674.79E-1368108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
KKNDKALIKS AGVKAIWTEE EDRELIRLVK NHGEKWTTVS GSMDRRIGKQ CRDRWNNHLR  60
PDIKKSCWTE DEDRAFVVAH KRYNNRWVKI AEEINGRTEN QVKNRWNNAN KRLSPKEKKY  120
RHSKNPPASP ILQEYINNMR NKSSGTTNKV ANAPTSDPSC RSGWLPMVDT LAAQIPLANQ  180
GGYYIPMVDT LAAHIPLVDQ GGEVVASPSL SFNFDVSLFY EEMFSIINEG ITDNVMSSNV  240
DHLSPCSVNK EMDLFEMISE ANI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-32131126106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9S7L23e-35MYB98_ARATH; Transcription factor MYB98
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11050.19e-39myb domain protein 64